General Information

  • ID:  hor003986
  • Uniprot ID:  Q5TV14(134-149)
  • Protein name:  Pyrokinin-1
  • Gene name:  CAPA
  • Organism:  Anopheles gambiae (African malaria mosquito)
  • Family:  Pyrokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  gambiae species complex, Pyretophorus, Cellia (subgenus), Anopheles (genus), Anophelinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  AGGTGANSAMWFGPRL
  • Length:  16(134-149)
  • Propeptide:  MLAGSQAKPPVCVALALVLLGVTVHLAGAEAPEFESVGRVSKRGPTVGLFAFPRVGRSDPELNLDWESSAMLPLETADDYEDYPMKEMKRQGLVPFPRVGRSGKSELAMAAARYWQAARNLQQQQQQQSVVKRAGGTGANSAMWFGPRLGKRSRFGAAAASGSSEQQQQLKAEQL
  • Signal peptide:  MLAGSQAKPPVCVALALVLLGVTVHLAGA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Myotropic activity
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: 3.3x10(-8)M
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q5TV14-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003986_AF2.pdbhor003986_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 186053 Formula: C70H105N21O20S
Absent amino acids: CDEHIKQVY Common amino acids: G
pI: 10.55 Basic residues: 1
Polar residues: 7 Hydrophobic residues: 6
Hydrophobicity: 1.88 Boman Index: -576
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 43.13
Instability Index: -410.63 Extinction Coefficient cystines: 5500
Absorbance 280nm: 366.67

Literature

  • PubMed ID:  17709098
  • Title:  Identification of One Capa and Two Pyrokinin Receptors From the Malaria Mosquito Anopheles Gambiae